RSAD2_MOUSE   Q8CBB9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8CBB9

Recommended name:Radical S-adenosyl methionine domain-containing protein 2

EC number:

Alternative names:(Viperin) (Virus inhibitory protein, endoplasmic reticulum-associated, interferon-inducible)

Cleaved into:

GeneID:58185

Gene names  (primary ):Rsad2

Gene names  (synonym ):Vig1

Gene names  (ORF ):

Length:362

Mass:41524

Sequence:MGMLVPTALAARLLSLFQQQLGSLWSGLAILFCWLRIALGWLDPGKEQPQVRGEPEDTQETQEDGNSTQPTTPVSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKQAGLEKINFSGGEPFLQDRGEYLGKLVRFCKEELALPSVSIVSNGSLIRERWFKDYGEYLDILAISCDSFDEQVNALIGRGQGKKNHVENLQKLRRWCRDYKVAFKINSVINRFNVDEDMNEHIKALSPVRWKVFQCLLIEGENSGEDALREAERFLISNEEFETFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCTGGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYVWSKADLKLDW

Tissue specificity:Expressed at higher levels in atherosclerotic arteries than in normal arteries. {ECO:0000269|PubMed:15890971}.

Induction:By interferon type I, type II and LPS. Induced by infection with Vesicular stomatitis virus and pseudorabies virus in dendritic cells, presumably through type I interferon pathway. {ECO:0000269|PubMed:11038379, ECO:0000269|PubMed:16849320}.

Developmental stage:

Protein families:Radical SAM superfamily, RSAD2 family


   💬 WhatsApp