DPH6_RAT   Q5M9F5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5M9F5

Recommended name:Diphthine--ammonia ligase

EC number:EC:6.3.1.14

Alternative names:ATP-binding domain-containing protein 4 Diphthamide synthase Diphthamide synthetase Protein DPH6 homolog

Cleaved into:

GeneID:362191

Gene names  (primary ):Dph6

Gene names  (synonym ):Atpbd4

Gene names  (ORF ):

Length:267

Mass:29,984

Sequence:MRVAALISGGKDSCYNMMRCIAEGHQIVALANLRPDDNQVESDELDSYMYQTVGHHAIDLYAEAMALPLYRRTIRGRSLETGRVYTRCEGDEVEDLYELLKLVKEKEEIEGVSVGAILSDYQRVRVENVCKRLNLQPLAYLWQRNQEDLLREMIASNIEAIIIKVAALGLDPDKHLGKTLGEMEPYLLELSKKYGVHVCGEGGEYETFTLDCPLFKKKIVVDTSEAVIHSADAFAPVAYLRLSGLHLEEKVSSVPGDDETTSYIHNS

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp