COX8B_RAT P16221
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P16221
Recommended name：Cytochrome c oxidase subunit 8B, mitochondrial
EC number：
Alternative names：
Cleaved into：
GeneID：25250
Gene names (primary )：Cox8b
Gene names (synonym )：Cox8h
Gene names (ORF )：
Length：70
Mass：7,549
Sequence：MPRLPPILRLLQAPEKYTVIPKARISSKPAKSPTSAMDQAVGMSVIIAGFMVPAGWVLSHLESYKRSSAA
Tissue specificity：Increased levels in liver during prenatal development.
Induction：
Developmental stage：
Protein families：