SOCS3_MOUSE O35718
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35718
Recommended name：Suppressor of cytokine signaling 3
EC number：
Alternative names：(SOCS-3) (Cytokine-inducible SH2 protein 3) (CIS-3) (Protein EF-10)
Cleaved into：
GeneID：12702
Gene names (primary )：Socs3
Gene names (synonym )：Cis3 Cish3
Gene names (ORF )：
Length：225
Mass：24776
Sequence：MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGTPSFSLPPTEPSSEVPEQPPAQALPGSTPKRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
Tissue specificity：Low expression in lung, spleen and thymus. Expressed in Th2 but not TH1 cells. {ECO:0000269|PubMed:12242343}.
Induction：By a subset of cytokines including EPO, leptin, LIF, IL-2, IL-3, IL-4, IGF1, growth hormone and prolactin. {ECO:0000269|PubMed:12847520}.
Developmental stage：In the developing brain, expressed at low levels from 10 dpc stages to young adulthood (P25) with peak levels from 14 dpc to P8. In the cortex, first expressed uniformly in all cells at 14 dpc. Not expressed in the retina. Highly expressed in fetal liver progenitors at 12.5 dpc.
Protein families：