TSN32_MOUSE Q9JHH2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JHH2
Recommended name：Tetraspanin-32
EC number：
Alternative names：(Tspan-32) (AML1-regulated transmembrane protein 1) (Protein Phemx)
Cleaved into：
GeneID：27027
Gene names (primary )：Tspan32
Gene names (synonym )：Art1 Phemx Tssc6
Gene names (ORF )：
Length：256
Mass：28906
Sequence：MGHWNRIKIAKCQILITNFLVLLLGLSMATMVVVIHFGDHFTVIGHASLERNPYETLRYWAFYVGISLAGLLSLGAALSTIATVREAHGLMAAGFLCFALSFCILVQVAFWRFYNPTQVEDAVLDTYDFVYDQAMKSPSSNWWQELAVIQDTFLCCGKKSPFGLLVSTGAIMCQGREAMREDCLQSIRNVLWTHYSIASILTCTSLALTVYAMMLCAFLWFAIHSYHGLDRKGRYSLTPPRSHGFQTQEPSLFRWT
Tissue specificity：Expressed exclusively in hematopoietic tissues. Expression detected in spleen, thymus, bone marrow and peripheral blood leukocytes but not in heart, brain, lung, liver, kidney or testis. {ECO:0000269|PubMed:10950922}.
Induction：
Developmental stage：Expressed from early embryogenesis through to adulthood. {ECO:0000269|PubMed:10950922}.
Protein families：Tetraspanin (TM4SF) family