TM121_MOUSE   Q80XA0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q80XA0

Recommended name:Transmembrane protein 121

EC number:

Alternative names:(Protein hole)

Cleaved into:

GeneID:69195

Gene names  (primary ):Tmem121

Gene names  (synonym ):Hole

Gene names  (ORF ):

Length:318

Mass:35684

Sequence:MVLPPPDRRHVCLTTLVIMGSMAVMDAYLVEQNQGPRKIGVCIIVLVGDVCFLLVLRYVAVWVGAEVRTAKRGYAMILWFLYIFVLEIKLYFIFQNYKAARRGAADPVARKALTLLLSVCVPGLFLLLVALDRMEYVRTFRKREDLRGRLFWVALDLLDLLDMQANLWEPPRTGLPLWAEGLTFFYCYMLLLVLPCVALSEVSMQGEHIAPQKMMLYPVLSLATVNVVAVLARAANMALFRDSRVSAIFVGKNVVALATKACTFLEYRRQVRDFPPPALALELQPPPSQRNSVPPPPPLHGPPVRPHGPSPTRDALDT

Tissue specificity:

Induction:

Developmental stage:Displays strong neural pattern at 8.5 dpc to 12.5 dpc. Not expressed in the heart. {ECO:0000269|PubMed:12204283}.

Protein families:TMEM121 family


   💬 WhatsApp