ZNHI3_MOUSE Q9CQK1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CQK1
Recommended name：Zinc finger HIT domain-containing protein 3
EC number：
Alternative names：(Thyroid hormone receptor interactor 3) (Thyroid receptor-interacting protein 3) (TR-interacting protein 3) (TRIP-3)
Cleaved into：
GeneID：448850
Gene names (primary )：Znhit3
Gene names (synonym )：Trip3
Gene names (ORF )：
Length：151
Mass：17068
Sequence：MASLNCRTAVCVVCLEKPKYRCPTCRVPYCSVPCFQKHKEQCSSEARPVEKRRAGPPVRSEESKDDDSSVADFLNSDEEEDRVSLQNLKNLGESETLRSLLLNPHLRQLMISLDQGDNKAKLMRACMQEPLFVEFADCCLGIVEPSQKRDS
Tissue specificity：Expressed in the cerebellum. {ECO:0000269|PubMed:28335020}.
Induction：
Developmental stage：Detected in proliferating fetal granule cell precursors at embryonic day 16.5, in proliferating and post-mitotic granule cells at postnatal days 3 and 10. Expression in cerebellar Purkinje cells is strong at postnatal days 10 and 21. {ECO:0000269|PubMed:28335020}.
Protein families：