CEL_MOUSE   Q64285


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q64285

Recommended name:Bile salt-activated lipase

EC number:EC 3.1.1.13

Alternative names:(BAL) (Bile salt-stimulated lipase) (BSSL) (Carboxyl ester lipase) (Cholesterol esterase) (Pancreatic lysophospholipase) (Sterol esterase)

Cleaved into:

GeneID:12613

Gene names  (primary ):Cel

Gene names  (synonym ):Lip1

Gene names  (ORF ):

Length:599

Mass:65813

Sequence:MGRLEVLFLGLTCCLAAACAAKLGAVYTEGGFVEGVNKKLSLLGGDSVDIFKGIPFATAKTLENPQRHPGWQGTLKATNFKKRCLQATITQDNTYGQEDCLYLNIWVPQGRKQVSHNLPVMVWIYGGAFLMGSGQGANFLKNYLYDGEEIATRGNVIVVTFNYRVGPLGFLSTGDANLPGNFGLRDQHMAIAWVKRNIAAFGGDPDNITIFGESAGAASVSLQTLSPYNKGLIRRAISQSGMALSPWAIQKNPLFWAKTIAKKVGCPTEDTGKMAACLKITDPRALTLAYKLPVKKQEYPVVHYLAFIPVIDGDFIPDDPINLYNNTADIDYIAGINNMDGHLFATIDVPAVDKTKQTVTEEDFYRLVSGHTVAKGLKGAQATFDIYTESWAQDPSQENMKKTVVAFETDVLFLIPTEIALAQHKAHAKSAKTYSYLFSHPSRMPIYPKWMGADHADDLQYVFGKPFATPLGYRPQDRAVSKAMIAYWTNFARSGDPNMGNSPVPTHWYPYTLENGNYLDITKTITSASMKEHLREKFLKFWAVTFEVLPTVTGDQDTLTPPEDDSEVAPDPPSDDSQVVPVPPTDDSVEAQMPATIGF

Tissue specificity:EXpressed by eosinophils. {ECO:0000269|PubMed:11834744}.

Induction:

Developmental stage:

Protein families:Type-B carboxylesterase/lipase family


   💬 WhatsApp