NGF_MOUSE P01139
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P01139
Recommended name：Beta-nerve growth factor
EC number：
Alternative names：(Beta-NGF)
Cleaved into：
GeneID：18049
Gene names (primary )：Ngf
Gene names (synonym )：Ngfb
Gene names (ORF )：
Length：241
Mass：27077
Sequence：MSMLFYTLITAFLIGVQAEPYTDSNVPEGDSVPEAHWTKLQHSLDTALRRARSAPTAPIAARVTGQTRNITVDPRLFKKRRLHSPRVLFSTQPPPTSSDTLDLDFQAHGTIPFNRTHRSKRSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG
Tissue specificity：Detected in submaxillary gland (at protein level) (PubMed:1284621). Highly expressed in male submaxillary gland. Levels are much lower in female submaxillary gland (PubMed:6336309, PubMed:1284621). {ECO:0000269|PubMed:1284621, ECO:0000269|PubMed:6336309}.
Induction：Expression oscillates in a circadian manner in the suprachiasmatic nucleus (SCN) of the brain. {ECO:0000269|PubMed:23785138}.
Developmental stage：
Protein families：NGF-beta family