HCAR2_MOUSE Q9EP66
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9EP66
Recommended name：Hydroxycarboxylic acid receptor 2
EC number：
Alternative names：(G-protein coupled receptor 109) (G-protein coupled receptor 109A) (G-protein coupled receptor HM74) (Niacin receptor 1) (Nicotinic acid receptor) (Protein PUMA-G)
Cleaved into：
GeneID：80885
Gene names (primary )：Hcar2
Gene names (synonym )：Gpr109 Gpr109a Gpr109b Niacr1 Pumag
Gene names (ORF )：
Length：360
Mass：41401
Sequence：MSKSDHFLVINGKNCCVFRDENIAKVLPPVLGLEFVFGLLGNGLALWIFCFHLKSWKSSRIFLFNLAVADFLLIICLPFLTDNYVHNWDWRFGGIPCRVMLFMLAMNRQGSIIFLTVVAVDRYFRVVHPHHFLNKISNRTAAIISCFLWGLTIGLTVHLLYTNMMTKNGEAYLCSSFSICYNFRWHDAMFLLEFFLPLAIILFCSGRIIWSLRQRQMDRHAKIKRAINFIMVVAIVFIICFLPSVAVRIRIFWLLYKYNVRNCDIYSSVDLAFFTTLSFTYMNSMLDPVVYYFSSPSFPNFFSTCINRCLRKKTLGEPDNNRSTSVELTGDPSTTRSIPGALMADPSEPGSPPYLASTSR
Tissue specificity：Expressed in lungs, spleen, heart, skeletal muscle and adipose tissue. {ECO:0000269|PubMed:11745392, ECO:0000269|PubMed:12646212}.
Induction：By interferon-gamma in macrophages. {ECO:0000269|PubMed:11745392}.
Developmental stage：
Protein families：G-protein coupled receptor 1 family