PLPP3_RAT P97544
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P97544
Recommended name：Phospholipid phosphatase 3 Curated
EC number：EC:3.1.3.-
Alternative names：Differentially expressed in rat intestine 42 (Dri42) Lipid phosphate phosphohydrolase 3 PAP2-beta Phosphatidate phosphohydrolase type 2b Phosphatidic acid phosphatase 2b (PAP-2b; PAP2b)
Cleaved into：
GeneID：
Gene names (primary )：Plpp3
Gene names (synonym )：Lpp3, Ppap2b
Gene names (ORF )：
Length：312
Mass：35,318
Sequence：MQSYKYDKAIVPESKNGGSPALNNNPRKGGSKRVLLICLDLFCLFMAALPFLIIETSTIKPYRRGFYCNDESIKYPLKVSETINDAVLCAVGIVIAILRIITGEFYRIYYLKEKSRSTIQNPYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCDPDFSQINCSEGYIQNYRCRGEDSKVQEARKSFFSGHASFSMFTMLYLVLYLQARFTWRGARLLRPLLQFTLLMMAFYTGLSRVSDYKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTTLSLPAPAIRREILSPVDIMDRSNHHNMV
Tissue specificity：Detected in epithelial cells of intestinal mucosa, lung, liver and brain. 2 s
Induction：
Developmental stage：Expression is increased during epithelial differentiation in intestinal mucosa as well as in kidney, liver and lung. 1
Protein families：