CK2N2_RAT Q9Z2N6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z2N6
Recommended name：Calcium/calmodulin-dependent protein kinase II inhibitor 2
EC number：
Alternative names：
Cleaved into：
GeneID：59314
Gene names (primary )：Camk2n2
Gene names (synonym )：
Gene names (ORF )：
Length：79
Mass：8,628
Sequence：MSEILPYGEDKMGRFGADPEGSDLSFSCRLQDTNSFFAGNQAKRPPKLGQIGRAKRVVIEDDRIDDVLKGMGEKPPSGV
Tissue specificity：Expressed in forebrain, hippocampus, midbrain, cerebellum, and testis. Expressed in forebrain, hippocampus, midbrain, and cerebellum (at protein level). In the cortex expressed more in laminae II and III than in laminae IV-VI. Expressed within the pyramidal layer of the hippocampus and granular layer of the dentate gyrus as well as in the olfactory bulb. Diffusely expressed within the caudate-putamen and globus pallidus. Diffusely expressed throughout regions of the midbrain. In cerebellum, expressed within the Purkinje and granular layer. Stronger expressed in the cerebellum. Highly expressed in frontal cortex, hippocampus, olfactory bulb, caudate-putamen and cerebellum exhibit (at protein level). 2 s
Induction：
Developmental stage：
Protein families：