EPPI_MOUSE Q9DA01
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9DA01
Recommended name：Eppin
EC number：
Alternative names：(Epididymal protease inhibitor) (Serine protease inhibitor-like with Kunitz and WAP domains 1)
Cleaved into：
GeneID：75526
Gene names (primary )：Eppin
Gene names (synonym )：Spinlw1
Gene names (ORF )：
Length：134
Mass：15470
Sequence：MKLSGFVSILVLFGLLARVQGPSLADLLFPRRCPRFREECEHQERDLCTRDRDCPKKEKCCVFNCGKKCLNPQQDICSLPKDSGYCMAYFRRWWFNKENSTCQVFIYGGCQGNNNNFQSQSICQNACEKKSSLT
Tissue specificity：Expressed in differentiated spermatogonia in testis. Expressed in spermatogonia cell lines GC-1 spg and GC-2spd(ts) as well as in the Leydig tumor cell line MLTC-1 (at protein level). Expressed specifically in epididymis and testis. Expressed predominantly on the postacrosomal region of mouse spermatozoa, in Sertoli cells, Leydig cells, and round spermatids in the testis, and in the principal cells of the cauda epididymidis epithelium. {ECO:0000269|PubMed:12909348, ECO:0000269|PubMed:21461566}.
Induction：Androgen dependent. Down-regulated in Sertoli cell-selective androgen receptor knockout mice. {ECO:0000269|PubMed:16166195}.
Developmental stage：
Protein families：