ASF1B_MOUSE   Q9DAP7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9DAP7

Recommended name:Histone chaperone ASF1B

EC number:

Alternative names:(Anti-silencing function protein 1 homolog B) (mCIA-II)

Cleaved into:

GeneID:66929

Gene names  (primary ):Asf1b

Gene names  (synonym ):

Gene names  (ORF ):

Length:202

Mass:22464

Sequence:MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALSDDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYPDPELRENPPPKPDFSQLQRNILASNPRVTRFHINWDNNPDSLEAIENQDPNVDFSLSLSCTPVKSLGLPSCIPGLLPENSMDCI

Tissue specificity:Highly expressed in testis. Restricted to premeiotic to meiotic stages during spermatogenesis. {ECO:0000269|PubMed:12842904}.

Induction:

Developmental stage:

Protein families:ASF1 family


   💬 WhatsApp