OVOL1_MOUSE Q9WTJ2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9WTJ2
Recommended name：Putative transcription factor Ovo-like 1
EC number：
Alternative names：(mOvo1) (mOvo1a)
Cleaved into：
GeneID：18426
Gene names (primary )：Ovol1
Gene names (synonym )：
Gene names (ORF )：
Length：267
Mass：30222
Sequence：MPRAFLVKKPCVSTCKRNWSELPDEERGEIYVPVSLGFCPPQPYREPEASVAEPPSCPLALDMSLRDSSYSVAPGPCVVAQLPSEDVSHLTDPQSRDQGFLRTKMKVTLGDSPNGDLFTCHICQKSFTHQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKERHPDSPLLRKTSKKVAVALQNTVTSLLQGSPHL
Tissue specificity：Expressed in skin, testis, kidney and weakly in lung. Not detected in heart, brain, spleen, liver and skeletal muscle.
Induction：
Developmental stage：First expressed at 14.5 dpc in the suprabasal layers of developing epidermis, at 15.5 dpc expression begins in the inner cells of developing hair germs and restricted to inner root sheath and/or precortical cells of developing hair follicles.
Protein families：