QKI_MOUSE Q9QYS9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QYS9
Recommended name：Protein quaking
EC number：
Alternative names：(MqkI) (qkI)
Cleaved into：
GeneID：19317
Gene names (primary )：Qki
Gene names (synonym )：Qk Qk1 Qka1
Gene names (ORF )：
Length：341
Mass：37671
Sequence：MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLGAVATKVRRHDMRVHPYQRIVTADRAATGN
Tissue specificity：Highly expressed in myelin-forming cells. Expressed in oligodendrocytes and astrocytes in the central nervous system as well as Schwann cells in the peripheral nervous system. Also expressed in the yolk sac endoderm, adjacent to the mesodermal site of developing blood islands, where the differentiation of blood and endothelial cells first occurs (at protein level). Expressed in brain, lung, heart and testis. {ECO:0000269|PubMed:8589716, ECO:0000269|PubMed:8987822, ECO:0000269|PubMed:9778149}.
Induction：
Developmental stage：Expressed in neural progenitors of the ventricular zone (vz) during CNS development, but that expression is down-regulated during neuronal differentiation. By contrast, neural progenitors located in specific subdomains of the vz maintain expression as they differentiate and migrate away into the emerging nervous system. These have characteristics consistent with the acquisition of a glial rather than neuronal fate (at protein level) First detected in the neuroepithelium of the head folds at 7.5 dpc. Expression is strongly present ventrally in the nascent brain and neural tube of 8.5 dpc and 9.5 dpc and in the heart of 8.5 dpc. Isoform 1 is expressed in early embryos, while isoform 3 and isoform 4 are found in late development when myelination begins.
Protein families：