NCMAP_MOUSE Q99JS0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q99JS0
Recommended name：Noncompact myelin-associated protein
EC number：
Alternative names：(Myelin protein of 11 kDa) (MP11)
Cleaved into：
GeneID：230822
Gene names (primary )：Ncmap
Gene names (synonym )：
Gene names (ORF )：
Length：100
Mass：10846
Sequence：MTTATTLGDAVFSLNMTRGEDALYKSSGAIVAAIVVVVIIIVTLVLILLKMYNRRMRTRRELEPKSPKPPVPPALDPSSNGSQQPATVTFDPANVHVETR
Tissue specificity：Found in the peripheral nervous system (PNS) Schwann cells (at protein level). Expressed in the PNS, primarily limited to Schwann cells. {ECO:0000269|PubMed:18650334}.
Induction：Up-regulated in Schwann cells by EGR2 during nerve development and after nerve injury. {ECO:0000269|PubMed:18650334}.
Developmental stage：Expressed in sciatic nerve and placenta at 15.5 dpc.
Protein families：