OREX_RAT O55232
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O55232
Recommended name：Hypocretin neuropeptide precursor Imported
EC number：
Alternative names：Orexin-A 1 Publication Alternative names: Hypocretin-1 1 Publication (Hcrt1 Curated) Orexin-B 1 Publication Alternative names: Hypocretin-2 1 Publication (Hcrt2 Curated)
Cleaved into：
GeneID：25723
Gene names (primary )：Hcrt
Gene names (synonym )：Ox, Ppox
Gene names (ORF )：
Length：130
Mass：13,645
Sequence：MNLPSTKVPWAAVTLLLLLLLPPALLSLGVDAQPLPDCCRQKTCSCRLYELLHGAGNHAAGILTLGKRRPGPPGLQGRLQRLLQANGNHAAGILTMGRRAGAELEPYPCPGRRCPTATATALAPRGGSRV
Tissue specificity：Mainly expressed in the brain, with expression in neurons in the dorsal lateral hypothalamic area (at protein level) (PubMed:9419374). Produced by a small group of neurons restricted to the lateral and posterior hypothalamus and perifornical areas (PubMed:9491897). Positive neurons project widely throughout the entire neuroaxis (PubMed:9491897). Particularly abundant projections in the cerebral cortex, olfactory bulb, hippocampus, amygdala, septum, diagonal band of Broca, bed nucleus of the stria terminalis, thalamus, anterior and posterior hypothalamus, midbrain, brainstem, and spinal cord (PubMed:9491897). Also expressed in the enteric nervous system and pancreas (PubMed:9491897). In small amount, also detected in the testis (PubMed:9491897). 2 s
Induction：Detected in the brain as early as embryonic day 18, but expression increases dramatically after the third postnatal week. 1 Publication
Developmental stage：By nutritional state, up-regulated by fasting, fluid deprivation and insulin-induced hypoglycemia. Orexin-A immunoreactivity varies diurnally and peaks during the dark phase, in the pons and the location of locus coeruleus. 1
Protein families：