NRBF2_MOUSE Q8VCQ3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8VCQ3
Recommended name：Nuclear receptor-binding factor 2
EC number：
Alternative names：(NRBF-2)
Cleaved into：
GeneID：641340
Gene names (primary )：Nrbf2
Gene names (synonym )：
Gene names (ORF )：
Length：287
Mass：32501
Sequence：MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHRKATTYLSEAMKLTESEQAHLSLELQRDSHMKQLLLIQERWKRAKREERLKAQQSTERDGAPHLQAPPRPSEDAEGQSPLLSQPYIPSTERRLPEVQGVFDRDPDTLLFLLQQKNEPSEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGTAEKELDVDADFVEKSELWGLPSHSESAAASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMND
Tissue specificity：
Induction：
Developmental stage：During embryonic brain development detected in the cerebral cortex at 14 dpc; expressed in the walls of the third and fourth ventricles, and in the hippocampus. In the adult brain, predominantly expressed in Purkinje cells of the cerebellum and neurons in the CA3 region of the hippocampus (PubMed:18619852). {ECO:0000269|PubMed:18619852}.
Protein families：