PEA15_MOUSE Q62048
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62048
Recommended name：Astrocytic phosphoprotein PEA-15
EC number：
Alternative names：(15 kDa phosphoprotein enriched in astrocytes)
Cleaved into：
GeneID：18611
Gene names (primary )：Pea15
Gene names (synonym )：Pea15a
Gene names (ORF )：
Length：130
Mass：15054
Sequence：MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEEELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA
Tissue specificity：Predominantly expressed in the brain. Low levels in some peripheral organs.
Induction：
Developmental stage：
Protein families：