SELT_MOUSE   P62342


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P62342

Recommended name:Thioredoxin reductase-like selenoprotein T

EC number:EC 1.8.1.9

Alternative names:(SelT) (EC 1.8.1.9)

Cleaved into:

GeneID:69227

Gene names  (primary ):Selenot

Gene names  (synonym ):Selt

Gene names  (ORF ):

Length:195

Mass:22292

Sequence:MRLLLLLLVAASAVVRSEASANLGGVPSKRLKMQYATGPLLKFQICVSUGYRRVFEEYMRVISQRYPDIRIEGENYLPQPIYRHIASFLSVFKLVLIGLIIVGKDPFAFFGMQAPSIWQWGQENKVYACMMVFFLSNMIENQCMSTGAFEITLNDVPVWSKLESGHLPSMQQLVQILDNEMKLNVHMDSIPHHRS

Tissue specificity:Ubiquitous. Highly expressed in the endocrine pancreas (PubMed:23913443). Expressed at low levels in the adult brain (PubMed:26866473). {ECO:0000269|PubMed:23913443, ECO:0000269|PubMed:26866473}.

Induction:Rapidly induced by ADCYAP1/PACAP neuropeptide (PubMed:23913443). In striatum neurons and astrocytes, induced by Parkinson disease-inducing neurotoxins such as 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (MPTP) or rotenone (PubMed:26866473). {ECO:0000269|PubMed:23913443, ECO:0000269|PubMed:26866473}.

Developmental stage:

Protein families:SelWTH family, Selenoprotein T subfamily


   💬 WhatsApp