B3GN8_MOUSE   Q8R3I9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8R3I9

Recommended name:UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8

EC number:EC 2.4.1.-

Alternative names:(BGnT-8) (Beta-1,3-Gn-T8) (Beta-1,3-N-acetylglucosaminyltransferase 8) (Beta3Gn-T8) (EC 2.4.1.-)

Cleaved into:

GeneID:232984

Gene names  (primary ):B3gnt8

Gene names  (synonym ):B3galt7

Gene names  (ORF ):

Length:389

Mass:43370

Sequence:MRCRKCQLCLSALLTLLGLKVYIEWTSESWLKKAEPRGALPSPTPPNAEPTLPTNLSARLGQTGPLSSAYWNQQQRQLGVLPSTDCQTWGTVAASEILDFILYPQELRRFLLSAACRSFPLWLPAGEGSPVASCSDKDVPYLLLAVKSEPGHFAARQAVRETWGSPVAGTRLLFLLGSPLGMGGPDLRSLVTWESRRYGDLLLWDFLDVPYNRTLKDLLLLTWLSHHCPDVNFVLQVQDDAFVHIPALLEHLQTLPPTWARSLYLGEIFTQAKPLRKPGGPFYVPKTFFEGDYPAYASGGGYVISGRLAPWLLQAAARVAPFPFDDVYTGFCFRALGLAPRAHPGFLTAWPAERTRDPCAVRGLLLVHPVSPQDTIWLWRHLWVPELQC

Tissue specificity:

Induction:

Developmental stage:

Protein families:Glycosyltransferase 31 family


   💬 WhatsApp