CD20_MOUSE P19437
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P19437
Recommended name：B-lymphocyte antigen CD20
EC number：
Alternative names：(B-cell differentiation antigen Ly-44) (Lymphocyte antigen 44) (Membrane-spanning 4-domains subfamily A member 1) (CD antigen CD20)
Cleaved into：
GeneID：12482
Gene names (primary )：Ms4a1
Gene names (synonym )：Cd20 Ly-44 Ms4a2
Gene names (ORF )：
Length：291
Mass：31958
Sequence：MSGPFPAEPTKGPLAMQPAPKVNLKRTSSLVGPTQSFFMRESKALGAVQIMNGLFHITLGGLLMIPTGVFAPICLSVWYPLWGGIMYIISGSLLAAAAEKTSRKSLVKAKVIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP
Tissue specificity：
Induction：
Developmental stage：
Protein families：MS4A family