K22E_MOUSE Q3TTY5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q3TTY5
Recommended name：Keratin, type II cytoskeletal 2 epidermal
EC number：
Alternative names：(Cytokeratin-2e) (CK-2e) (Epithelial keratin-2e) (Keratin-2 epidermis) (Keratin-2e) (K2e) (Type-II keratin Kb2)
Cleaved into：
GeneID：16681
Gene names (primary )：Krt2
Gene names (synonym )：K2e Krt2-17 Krt2a
Gene names (ORF )：
Length：707
Mass：70923
Sequence：MSCQISCRSRRGGGGGGGGGFRGFSSGSAVVSGGSRRSNTSFSCISRHGGGRGGSGGGGFGSQSLVGLGGYKSISSSVAGNSGGYGGSSFGGSSGFGGGRGFGGGQGFGGSGGFGGGSGFGGGQGFGGGSRFGGGSGFGGGGFGGGSFGGGRFGGGPGGFGGPGGFPGGGIHEVSVNQSLLQPLDVKVDPEIQNVKSQEREQIKTLNNKFASFIDKVRFLEQQNQVLRTKWELLQQLDVGSRTTNLDPIFQAYIGMLKKQVDRLSAERTSQESELNNMQDLVEDFKKKYEDEINKRTSAENDFVTIKKDVDSCYMDKTELQARLDILAQEVNFLRTLYDAELSQLQQDVTDTNVILSMDNNRNLDLDSIIAEVQNQYEMIAHKSKAESEELYHSKYEELQVTAVKHGDSLKEIKMEISELNRTIQRLQGEISHVKKQCKGVQDSIADAEQRGEHAIKDARGKLTDLEEALQQCREDLARLLRDYQELMNTKLSLDVEIATYRKLLEGEECRMSGDFSDNVSVSITSSTISSSVASKTGFGSGGQSSGGRGSYGGRGGGGGGGSTYGSGGRSSGSRGSGSGSGGGGYSSGGGSRGGSGGGYGSGGGSRGGSGGGYGSGGGSGSGGGYSSGGGSRGGSGGGGVSSGGGSRGGSSSGGGSRGGSSSGGGGYSSGGGSRGGSSSGGAGSSSEKGGSGSGEGCGSGVTFSFR
Tissue specificity：Expressed predominantly in the suprabasal layers of the plantar epidermis outside of the footpads (at protein level) (PubMed:26603179). Expressed mainly in the middle spinous and granular cells of the epidermis of adult tail, nipple and footsole skin. Also found in ear. {ECO:0000269|PubMed:15118396, ECO:0000269|PubMed:2448177, ECO:0000269|PubMed:26603179, ECO:0000269|PubMed:7508961}.
Induction：
Developmental stage：Induction occurs during the first 2 weeks after birth, being first observed in the epidermis of tail then the footpad and later in the ear. {ECO:0000269|PubMed:2448177}.
Protein families：Intermediate filament family