B2CL2_MOUSE P70345
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P70345
Recommended name：Bcl-2-like protein 2
EC number：
Alternative names：(Bcl2-L-2) (Apoptosis regulator Bcl-W) (c98)
Cleaved into：
GeneID：12050
Gene names (primary )：Bcl2l2
Gene names (synonym )：Bclw Kiaa0271
Gene names (ORF )：
Length：193
Mass：20790
Sequence：MATPASTPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
Tissue specificity：Expressed in almost all myeloid cell lines and in a wide range of tissues, with highest levels in brain, colon, and salivary gland.
Induction：By Igf1. {ECO:0000269|PubMed:14746907}.
Developmental stage：Expressed in both mitotic and postmitotic Sertoli cells. {ECO:0000269|PubMed:11784036}.
Protein families：Bcl-2 family