RPAB2_RAT O88828
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O88828
Recommended name：DNA-directed RNA polymerases I, II, and III subunit RPABC2
EC number：
Alternative names：DNA-directed RNA polymerase II subunit F RPB6 homolog
Cleaved into：
GeneID：83503
Gene names (primary )：Polr2f
Gene names (synonym )：
Gene names (ORF )：
Length：127
Mass：14,464
Sequence：MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIISD
Tissue specificity：
Induction：
Developmental stage：
Protein families：