DFB50_MOUSE Q6TU36
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6TU36
Recommended name:Beta-defensin 50
EC number:
Alternative names:(BD-50) (mBD-50) (Defensin, beta 37) (Defensin, beta 50) (Prostate beta-defensin 1)
Cleaved into:
GeneID:387334
Gene names (primary ):Defb50
Gene names (synonym ):Defb37 Pbd1
Gene names (ORF ):
Length:73
Mass:8058
Sequence:MKTLCFLLLTSGLLYLMVKGVGSHPGTFHVRIKCMPKMTAVFGDNCSFYSSMGDLCNNTKSVCCMVPVRMDNI
Tissue specificity:Highly expressed in prostate. Not expressed in uterus, epididymis, ovary, testis, spleen, submaxillary gland, thymus, thyroid, pancreas, smooth muscle, skeletal muscle, heart, kidney, lung, liver, eye and brain. {ECO:0000269|PubMed:14659016}.
Induction:
Developmental stage:
Protein families:Beta-defensin family