VGLU1_RAT   Q62634


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q62634

Recommended name:Vesicular glutamate transporter 1 1 Publication

EC number:

Alternative names:Brain-specific Na(+)-dependent inorganic phosphate cotransporter 1 Publication Solute carrier family 17 member 7

Cleaved into:

GeneID:

Gene names  (primary ):Slc17a7

Gene names  (synonym ):Bnpi, Vglut1

Gene names  (ORF ):

Length:560

Mass:61,665

Sequence:MEFRQEEFRKLAGRALGRLHRLLEKRQEGAETLELSADGRPVTTHTRDPPVVDCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQKAQFNWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPVTKFNTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRHIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWAEPEEMSEEKCGFVGHDQLAGSDESEMEDEVEPPGAPPAPPPSYGATHSTVQPPRPPPPVRDY

Tissue specificity:Expressed in the cerebellum, cerberal cortex and hippocampus. Isoform 2 is expressed specifically in retina. 5 s

Induction:Expression of isoform 2 increases sharply during the first ten days of postnatal life, and also increases with increasing numbers of rhodopsin cells in the retina. 1 Publication

Developmental stage:Induced within cerebellar granule cells by exposure to N-methyl-D-aspartate (NMDA). 1

Protein families:


   💬 WhatsApp