C1QT5_RAT   Q5FVH0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5FVH0

Recommended name:Complement C1q tumor necrosis factor-related protein 5

EC number:

Alternative names:

Cleaved into:

GeneID:315598

Gene names  (primary ):C1qtnf5

Gene names  (synonym ):Ctrp5

Gene names  (ORF ):

Length:243

Mass:25,334

Sequence:MRPLLALLLLGLASGSPPLDDNKIPSLCPGQPGLPGTPGHHGSQGLPGRDGRDGRDGAPGAPGEKGEGGRPGLPGPRGEPGPRGEAGPVGAIGPAGECSVPPRSAFSAKRSESRVPPPADTPLPFDRVLLNEQGHYDATTGKFTCQVPGVYYFAVHATVYRASLQFDLVKNGQSIASFFQFFGGWPKPASLSGGAMVRLEPEDQVWVQVGVGDYIGIYASIKTDSTFSGFLVYSDWHSSPVFA

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp