PNDC1_MOUSE   B2RXZ1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:B2RXZ1

Recommended name:Poly(A)-specific ribonuclease PNLDC1

EC number:EC 3.1.13.4

Alternative names:(PARN-like domain-containing protein 1) (Poly(A)-specific ribonuclease domain-containing protein 1)

Cleaved into:

GeneID:240023

Gene names  (primary ):Pnldc1

Gene names  (synonym ):

Gene names  (ORF ):

Length:531

Mass:61292

Sequence:MDVGADEFEQSLPLLQELVAGADFVGLDIEFTGLRSNLSRPQQISLFDLPSEWYLKTRQSVQQFTICQIGLSMFSSIEGESNKYVAHSCNFFLFPTTFGILDSEFSFQASSVQFLNQYGFDYNKFLKNGIPYMNEEQEKKIKHSILRGNWRVRSSLDKDQIKVVIDKVTQWLDLAEEGDQMTLPGIAGFQAFEVQLVLRQALPNIWTVLKEEWVIVKKVSQPQRWYLEHASCDQVSCWKEQILLSARGFSVFFQMLVKAQKPLVGHNMMMDLLHLHEKFFRPLPESYDQFKQNIHSLFPVLIDTKNVTKDIWKELRFPRVSNLLEVYEVLSSNLNPTKDSGPVIIHARQCKKYAETKCPHEAAYDAFLCGSVLLKVAHLLLQRVHGNGAVHEPAFPQYLDVLAPYVNQVNLIRAGVPKINFSGPDYPSIRPPVLILTVKRWPGVSEQQVYREFQNLCKFDVRRFTRSQFLLLTNKFKDARSVLKEYRNHPTLQVSLYRSWRHSPNITCLLQVCSIVTTWAMIAFLLGRPMP

Tissue specificity:Specifically expressed in embryonic stem cells (PubMed:27515512). Highly expressed in testis (PubMed:26919431, PubMed:27515512). {ECO:0000269|PubMed:26919431, ECO:0000269|PubMed:27515512}.

Induction:Down-regulated in differentiated cells, due to methylation of its promoter by the methyltransferase DNMT3B. {ECO:0000269|PubMed:27515512}.

Developmental stage:Expressed during early embryo development and fades during differentiation. {ECO:0000269|PubMed:27515512}.

Protein families:CAF1 family


   💬 WhatsApp