SIA4B_RAT Q11205
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q11205
Recommended name：CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2
EC number：EC:2.4.3.4
Alternative names：Alpha 2,3-ST 2; Beta-galactoside alpha-2,3-sialyltransferase 2
Cleaved into：
GeneID：64442
Gene names (primary )：St3gal2
Gene names (synonym )：Siat4b, Siat5
Gene names (ORF )：
Length：350
Mass：40,166
Sequence：MKCSLRVWFLSMAFLLVFIMSLLFTYSHHSMATLPYLDSGTLGGTHRVKLVPGYTGQQRLVKEGLSGKSCTCSRCMGDAGTSEWFDSHFDSNISPVWTRDNMNLTPDVQRWWMMLQPQFKSHNTNEVLEKLFQIVPGENPYRFRDPQQCRRCAVVGNSGNLRGSGYGQEVDSHNFIMRMNQAPTVGFEKDVGSRTTHHFMYPESAKNLPANVSFVLVPFKALDLMWIASALSTGQIRFTYAPVKSFLRVDKEKVQIYNPAFFKYIHDRWTEHHGRYPSTGMLVLFFALHVCDEVNVYGFGADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDILAKASKIEVYRGN
Tissue specificity：
Induction：
Developmental stage：
Protein families：