ZGLP1_MOUSE Q1WG82
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q1WG82
Recommended name：GATA-type zinc finger protein 1
EC number：
Alternative names：(GATA-like protein 1) (GLP-1)
Cleaved into：
GeneID：100009600
Gene names (primary )：Zglp1
Gene names (synonym )：Glp1
Gene names (ORF )：
Length：266
Mass：29107
Sequence：MEAAQAGDLTRRQELLAPPCLDTESLRKSRPPALEPGALRCLTPNIRSLWPTCQDSVSTALPFLQEKEKGLPGSPSPATQVLGSCWELMVIGMSDHLSMARNPRGTQCPNLEISSATSPASLQRRPRKQLNPRMGIEKVDPRFKGVTLEFQIQPDSSLQIVPTYSLPGRSCSQKLPASPSKALASPGSSEALGPRRCASCRTQRTPLWRDAEDGTPLCNACGIRYKKYGTRCSSCWLVPRKSIQPKRLCGRCGMSQDPHLSPTQEL
Tissue specificity：Specifically expressed in adult testis and ovary (PubMed:16982049). Expressed at high levels in the somatic cells of the developing gonads, including Leydig cells in the testes and granulosa cells in the ovaries (PubMed:16982049). {ECO:0000269|PubMed:16982049}.
Induction：Up-regulated in response to bone morphogenetic proteins (BMPs) signaling. {ECO:0000269|PubMed:32054698}.
Developmental stage：During female embryogenesis, specifically and transiently expressed in germ cells expressing Ddx4: expression starts at E12.0 and decreases after E14.5, a key period for the sex determination of germ cells (PubMed:21123517, PubMed:32054698). Not expressed in somatic cells or males during embryogenesis (PubMed:32054698). {ECO:0000269|PubMed:21123517, ECO:0000269|PubMed:32054698}.
Protein families：