TCAL8_RAT   Q6I7R5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6I7R5

Recommended name:Transcription elongation factor A protein-like 8

EC number:

Alternative names:Transcription elongation factor S-II protein-like 8 Up-regulated in nephrectomized rat kidney #1

Cleaved into:

GeneID:367909

Gene names  (primary ):Tceal8

Gene names  (synonym ):UR-NR#1

Gene names  (ORF ):

Length:117

Mass:13,447

Sequence:MQKSCDENEGTPQNTPKADEGHPSEDPPQQAGENLQASGENVREETDGSLRGEPAEPSPEPKEDTPARHLNPEEVIRGVDELERLREEIRRVRNKFVLMHWKQRHSRSRPYPVCFRP

Tissue specificity:Highly expressed in kidney. Moderately expressed in heart and lung. Low expression in brain and liver. Expression is up-regulated in nephrectomized kidney. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp