PO6F1_MOUSE Q07916
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q07916
Recommended name：POU domain, class 6, transcription factor 1
EC number：
Alternative names：(Octamer-binding transcription factor EMB) (Transcription regulatory protein MCP-1)
Cleaved into：
GeneID：
Gene names (primary )：Pou6f1
Gene names (synonym )：Emb
Gene names (ORF )：
Length：301
Mass：32852
Sequence：MPGISSQILTNAQGQVIGALPWVVNSASVATPAPAQSLQVQAVTPQLLLNAQGQVIATLASSPLPQPVAVRKPNTPESPAKSEVQPIQPTQAVPQPAVILTSPTPALKPSAATPIPITCSETPTVSQLVSKPHTPSLDEDGINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKWLMEAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQIP
Tissue specificity：Isoform C1 and isoform C2 are found in the brain, while isoform C7 is found in the testis.
Induction：
Developmental stage：Expressed in the embryo throughout post-implantation stages with the most prominent expression in the developing CNS. In the adult, it is highly expressed in brain whereas weaker expression can be detected in other organs.
Protein families：POU transcription factor family, Class-6 subfamily