KAD3_RAT P29411
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P29411
Recommended name:GTP:AMP phosphotransferase AK3, mitochondrial By Similarity
EC number:EC:2.7.4.10
Alternative names:Adenylate kinase 3 1 Publication Adenylate kinase 3 alpha-like 1 Imported Adenylate kinase isozyme 3 1 Publication
Cleaved into:
GeneID:26956
Gene names (primary ):Ak3 1 Publication
Gene names (synonym ):Ak3l1 Imported
Gene names (ORF ):
Length:227
Mass:25,438
Sequence:MGASGRLLRAVIMGAPGSGKGTGSSRITKHFELKHLSSGDLLRQNMLQGTEIAVLAKSFIDQGKLIPDDDMTRLALHELKNLTQCSWLLDGFPRTLPQAEALDRVYQIDTVINLNVPFEVIKLRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEAQTEPVLQYYQKKGVLETFSGTETNKIRPHVYSFLQMKVPETIQKASVTP
Tissue specificity:
Induction:
Developmental stage:
Protein families:adenylate kinase family