REG3A_RAT P35231
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P35231
Recommended name：Regenerating islet-derived protein 3-alpha
EC number：
Alternative names：Islet of Langerhans regenerating protein 3 (REG 3) Lithostathine 3 Pancreatitis-associated protein 2 RegIII Regenerating islet-derived protein III-alpha (Reg III-alpha)
Cleaved into：
GeneID：171162
Gene names (primary )：Reg3a
Gene names (synonym )：Pap2, Reg3
Gene names (ORF )：
Length：174
Mass：19,599
Sequence：MLPRLSFNNVSWTLLYYLFIFQVRGEDSQKAVPSTRTSCPMGSKAYRSYCYTLVTTLKSWFQADLACQKRPSGHLVSILSGGEASFVSSLVTGRVNNNQDIWIWLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGNCGSLTATSEFLKWGDHHCDVELPFVCKFKQ
Tissue specificity：Low expression found in healthy pancreas.
Induction：
Developmental stage：Appears in pancreatic juice after induction of pancreatic inflammation.
Protein families：