KLRBA_RAT P27471
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P27471
Recommended name：Killer cell lectin-like receptor subfamily B member 1A
EC number：
Alternative names：Antigen 3.2.3 CD161 antigen-like family member A Natural killer cell surface protein P1-3.2.3 (NKR-P1 3.2.3)
Cleaved into：
GeneID：362443
Gene names (primary )：Klrb1a
Gene names (synonym )：Nkrp1a
Gene names (ORF )：
Length：223
Mass：24,551
Sequence：MDTARVYLSLKPSKTAAGAQCVSPPSLPPDACRCPRSHRLALKLSCAGLILLVLALVGMSILVRVLVQKPSVEPCRVLIQENLSKTGSPAKLKCPKDWLSHRDKCFHVSQTSITWKESLADCGGKGATLLLVQDQEELRFLRNLTKRISSSFWIGLSYTLSDENWKWINGSTLNSDVLSITGDTEKDSCASVSQDKVLSESCDSDNIWVCQKELKCECMCNDS
Tissue specificity：Expressed in natural killer cells.
Induction：
Developmental stage：
Protein families：