LANC1_MOUSE O89112
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O89112
Recommended name：Glutathione S-transferase LANCL1
EC number：EC 2.5.1.18
Alternative names：(40 kDa erythrocyte membrane protein) (p40) (LanC-like protein 1)
Cleaved into：
GeneID：14768
Gene names (primary )：Lancl1
Gene names (synonym )：Gpr69a
Gene names (ORF )：
Length：399
Mass：45341
Sequence：MAQRAFPNPYADYNKSLAENYFDSTGRLTPEFSHRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAVLYLHLHNVFGDPAYLQMAHSYVKQSLNCLSRRSITFLCGDAGPLAVAAVLYHKMNSEKQAEECITRLIHLNKIDPHVPNEMLYGRIGYIFALLFVNKNFGEEKIPQSHIQQICENILTSGENLSRKRNLAAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVNQGKLHSLVKPSVDFVCRLKFPSGNYPPCLDDTRDLLVHWCHGAPGVIYMLIQAYKVFKEERYLCDAQQCADVIWQYGLLKKGYGLCHGAAGNAYAFLALYNLTQDLKYLYRACKFAEWCLDYGEHGCRTADTPFSLFEGMAGTIYFLADLLVPTKAKFPAFEL
Tissue specificity：Detected in spinal cord (at protein level). Ubiquitous. Strongly expressed in brain, testis, alveolar macrophages and epithelial cells of the lung, kidney and intestine (PubMed:17305318, PubMed:9714732). Expression in brain increases during the first postnatal month and remaining high in adult (PubMed:25158856). {ECO:0000269|PubMed:17305318, ECO:0000269|PubMed:25158856, ECO:0000269|PubMed:9714732}.
Induction：Induced by oxidative stress. {ECO:0000269|PubMed:25158856}.
Developmental stage：
Protein families：LanC-like protein family