TPGS1_MOUSE   Q99MS8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99MS8

Recommended name:Tubulin polyglutamylase complex subunit 1

EC number:

Alternative names:(PGs1) (p32)

Cleaved into:

GeneID:110012

Gene names  (primary ):Tpgs1

Gene names  (synonym ):Gm16517 Gtrgeo22

Gene names  (ORF ):

Length:303

Mass:32626

Sequence:MAALPVPLPPTKMAAVEKRRPAVAPAANFPDSGRTSVSQAAAAAESEEDFLRQLGVTEMLRAALLKVLEIRPEEPIAFLAHYFENMGLRSPTNGGAGEPPGQLLLQQQRLGRALWHLRLAHHSQRTAFNNNVSVAYECLSASGRKKKPGLDGRTYSELLKRVCRDGGAPEEVVAPLLRKIQCRDHEAVPLGIFRTGMLSCFVLLEFVARAGALFQLLEDPGQAVADRRVGQAVLDTLEGALSAGDMATAPTHYLEAGSRLGPDNLARALDRAASGRRPSVPMAREEFLEKAAALFIAKVKPVG

Tissue specificity:Broadly expressed at low levels. Highly expressed in brain. Present in brain neurons (at protein level). {ECO:0000269|PubMed:12242242, ECO:0000269|PubMed:12972506}.

Induction:

Developmental stage:In testis, expression strongly increases at P22. {ECO:0000269|PubMed:12242242}.

Protein families:


   💬 WhatsApp