CABS1_MOUSE Q8C633
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8C633
Recommended name：Calcium-binding and spermatid-specific protein 1
EC number：
Alternative names：
Cleaved into：
GeneID：70977
Gene names (primary )：Cabs1
Gene names (synonym )：
Gene names (ORF )：
Length：391
Mass：42302
Sequence：MAEDGSPKIYSRPPRDNSKTPTEADIFFGADNTIPKSETTITSEGDHVTSVNDCTPDGDFSTTVNKLTPTKEKLKLEDDIEGCLKLTTLPEKEITTPTETPNSKPKGSITENFIPVKIGNTSSPVGTVSLIDFSSNTAKEDIFLTTIDTGEKEVVPTTEFSGTLEDSAADVEDASGFPDESTETDVPSSATSDAPDDGAVQVTDSFSPEAGVPPSTEKEVTTIPDITNIAEENVTEIKLIVSEDRPKTVTKLSDSEEEKFITVFELTNSAEKAKDNVEDPLNDEESTDGANDWMEKETASEAESHAVLLTAVESRYDFIVTASETDNVMEESHVNTTDLPENETTESVTNVTEELPSVTSIVDTLKDKEDLSTTNSGLFKLLKEEPDDLMM
Tissue specificity：Detected only in testis. Expressed from stages X to VIII of the seminiferous epithelial cycle. Expressed from step 13 to step 16 of spermatid development (at protein level). {ECO:0000269|PubMed:19208547}.
Induction：Down-regulated by Busulfan. {ECO:0000269|PubMed:19208547}.
Developmental stage：
Protein families：