SAC1_RAT   Q9ES21


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9ES21

Recommended name:Phosphatidylinositol-3-phosphatase SAC1

EC number:EC:3.1.3.64

Alternative names:Phosphatidylinositol-4-phosphate phosphatase 1 Publication Suppressor of actin mutations 1-like protein

Cleaved into:

GeneID:116482

Gene names  (primary ):Sacm1l

Gene names  (synonym ):Sac1 1 Publication

Gene names  (ORF ):

Length:587

Mass:67,039

Sequence:MAATAYEHLKLHITPEKFYVEACDDGADDVLIIDRVSTEVTLAVKKDVPPSAVTRPIYGIMGTIHLVAGNYLVVITKKMKVGEFFNHVIWKATDFDVLSYKKTMLHLTDIQLQDNKTFLAMLNHVLSTDGFYFSTTYDLTHTLQRLSNTSPEFQEMSLLERADQRFVWNGHLLRELSAQPEVHRFALPVLHGFITMHSCSINGKYFDWILISRRSCFRAGVRYYVRGIDSEGHAANFVETEQIVHYSGNRASFVQTRGSIPVFWSQRPNLKYKPDPQINKVANHMDGFQRHFDSQVIIYGKQVIINLVNHKGSEKPLEQTFAKMVSSLGSGMIRYIAFDFHKECKNMRWDRLSILLDQVAEMQDELSYFLVDSAGKVVTNQEGVFRSNCMDCLDRTNVIQSLLARRSLQAQLQRLGVLHVGQKLEEQDEFEKIYKNAWADNANACAKQYAGTGALKTDFTRTGKRTQLGLVMDGFNSLLRYYKNNFSDGFRQDSIDLFLGNYSVDELDSHSPLSVPRDWKFLALPIIMVVAFSMCIICLLMAGDTWTETLAYVLFWGVASIGTFFIILYNGKDFVDAPRLVQKEKID

Tissue specificity:Detected in spleen, lung, liver, skeletal muscle, kidney, testis and in cerebellar Purkinje cells (at protein level). Ubiquitous. Highly expressed in brain, spleen, liver and kidney. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp