SRR1L_MOUSE   Q8K2M3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8K2M3

Recommended name:SRR1-like protein

EC number:

Alternative names:(SRR1 domain-containing protein)

Cleaved into:

GeneID:70118

Gene names  (primary ):Srrd

Gene names  (synonym ):

Gene names  (ORF ):

Length:249

Mass:27502

Sequence:MAAAALEPWSAVAPRRRKRAAGRRPRPGEGPRAEPEADGEAVLRRLREAEEDLRISDFCSSALETITECLRKQLEQLQPLTEALGRLHLGSSLPSASQEPLASSASHVKCVCYGLGTFASCPTARIQLAFMLLFLEKCQVPRSHCWVYDPLFSQTEVSVLTSLGVTVLSENEEGKRSVQGQPTVFYMPHCGTALYNNLLWSNWSADALSRVLIIGNSFRGLEERLLARILQENYPYIAKVSDRIAGPGF

Tissue specificity:

Induction:Up-regulated by hemin and 5-aminolevulinic acid. {ECO:0000269|PubMed:28802827}.

Developmental stage:

Protein families:SRR1 family


   💬 WhatsApp