CC21B_MOUSE P86792
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P86792
Recommended name：C-C motif chemokine 21b
EC number：
Alternative names：(6Ckine) (Beta-chemokine exodus-2) (Small-inducible cytokine A21b) (Thymus-derived chemotactic agent 4) (TCA4)
Cleaved into：
GeneID：100042493
Gene names (primary )：Ccl21b
Gene names (synonym )：Scya21 Scya21b
Gene names (ORF )：
Length：133
Mass：14584
Sequence：MAQMMTLSLLSLVLALCIPWTQGSDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFLPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG
Tissue specificity：Expressed strongly in lung, spleen, thymus, peripheral and mesentric lymph nodes. Also expressed in the testis, kidney, liver, and heart.
Induction：
Developmental stage：
Protein families：Intercrine beta (chemokine CC) family