CNIH1_MOUSE O35372
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35372
Recommended name：Protein cornichon homolog 1
EC number：
Alternative names：(CNIH-1) (Cornichon family AMPA receptor auxiliary protein 1) (Protein cornichon homolog)
Cleaved into：
GeneID：12793
Gene names (primary )：Cnih1
Gene names (synonym )：Cnih
Gene names (ORF )：
Length：144
Mass：16699
Sequence：MAFTFAAFCYMLALLLTAALIFFAIWHIIAFDELKTDYKNPIDQCNTLNPLVLPEYLIHAFFCVMFLCAAEWLTLGLNMPLLAYHIWRYMSRPVMSGPGLYDPTTIMNADILAYCQKEGWCKLAFYLLAFFYYLYGMIYVLVSS
Tissue specificity：Expressed in oocytes, and at a basal level in ovarian somatic cells of 6-week-old mouse. Expressed in adult brain.
Induction：
Developmental stage：Abundant in full grown oocyte and the ovulated unfertilized egg, shows a slight decrease 12 hours after fertilization. Transcripts from the activated embryonic genome are present in the eight-cell embryo.
Protein families：Cornichon family