CXCL9_MOUSE   P18340


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P18340

Recommended name:C-X-C motif chemokine 9

EC number:

Alternative names:(Gamma-interferon-induced monokine) (Monokine induced by interferon-gamma) (MIG) (MuMIG) (Protein m119) (Small-inducible cytokine B9)

Cleaved into:

GeneID:17329

Gene names  (primary ):Cxcl9

Gene names  (synonym ):Mig Scyb9

Gene names  (ORF ):

Length:126

Mass:14444

Sequence:MKSAVLFLLGIIFLEQCGVRGTLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKISQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT

Tissue specificity:

Induction:By interferon gamma.

Developmental stage:

Protein families:Intercrine alpha (chemokine CxC) family


   💬 WhatsApp