AR2BP_MOUSE Q9D385
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D385
Recommended name：ADP-ribosylation factor-like protein 2-binding protein
EC number：
Alternative names：(ARF-like 2-binding protein) (Binder of ARF2 protein 1)
Cleaved into：
GeneID：107566
Gene names (primary )：Arl2bp
Gene names (synonym )：Bart Bart1
Gene names (ORF )：
Length：163
Mass：18754
Sequence：MDALEEESFALSFSSASDAEFDAVVGCLEDIIMDDEFQLLQRNFMDKYYQEFEDTEENKLTYTPIFNEYISLVEKYIEEQLLERIPGFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSTPASQNNLRH
Tissue specificity：Widely expressed, with most abundant activity in brain, especially in hippocampus and cortex. Also expressed in lung, cerebellum, liver, kidney, retina, spleen, muscle and heart (at protein level). {ECO:0000269|PubMed:10488091, ECO:0000269|PubMed:11809823, ECO:0000269|PubMed:18234692, ECO:0000269|PubMed:23849777}.
Induction：
Developmental stage：
Protein families：ARL2BP family