BPIA2_MOUSE P07743
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P07743
Recommended name：BPI fold-containing family A member 2
EC number：
Alternative names：(Parotid secretory protein) (PSP)
Cleaved into：
GeneID：19194
Gene names (primary )：Bpifa2
Gene names (synonym )：Psp
Gene names (ORF )：
Length：235
Mass：24753
Sequence：MFQLGSLVVLCGLLIGNSESLLGELGSAVNNLKILNPPSEAVPQNLNLDVELLQQATSWPLAKNSILETLNTADLGNLKSFTSLNGLLLKINNLKVLDFQAKLSSNGNGIDLTVPLAGEASLVLPFIGKTVDISVSLDLINSLSIKTNAQTGLPEVTIGKCSSNTDKISISLLGRRLPIINSILDGVSTLLTSTLSTVLQNFLCPLLQYVLSTLNPSVLQGLLSNLLAGQVQLAL
Tissue specificity：Predominates in the parotid glands, present in smaller amounts (1/10) in the submaxillary glands and in the sublingual glands, and at lower amount in the pancreas but undetectable in the liver. Found also in lacrimal gland. {ECO:0000269|PubMed:9461541}.
Induction：
Developmental stage：Expressed at low levels at day 3 after birth but increased gradually with age from this time.
Protein families：BPI/LBP/Plunc superfamily, Plunc family