GUC2B_RAT P70668
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P70668
Recommended name：Guanylate cyclase activator 2B
EC number：
Alternative names：
Cleaved into：
GeneID：64055
Gene names (primary )：Guca2b
Gene names (synonym )：
Gene names (ORF )：
Length：106
Mass：11,573
Sequence：MSGSQLWAAVLLLLVLQSAQGVYIKYHGFQVQLESVKKLNELEEKQMSDPQQQKSGLLPDVCYNPALPLDLQPVCASQEAASTFKALRTIATDECELCINVACTGC
Tissue specificity：Expressed not only in the gastrointestinal tract but also in the lung, pancreas and kidney.
Induction：
Developmental stage：
Protein families：