HYLS1_MOUSE Q9CXX0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CXX0
Recommended name：Hydrolethalus syndrome protein 1 homolog
EC number：
Alternative names：
Cleaved into：
GeneID：76832
Gene names (primary )：Hyls1
Gene names (synonym )：
Gene names (ORF )：
Length：307
Mass：35141
Sequence：MAEKRQAYSVPEAMKQLIGPGGQKWANMDPEERMLAAATAFTRICAGQGEGDSRREAQAGQYDPYSKASVTPGKRPALPMHLHFPHTASRVTSSTVSETSQKCRKPVMKRKVLRRKPDGEVLVTDESVISECESGTESDLGLWDLRHRFMNLQFQEGTESPVVTSQKFNLPCEYQGISQEDQLICYLQREEMDPPVYEQDLIVASRPKSFILPRLDQLSRNRGKIDRVARYFEYKRDWDSMRFPGEDHRKELRWSVRGQMLSRTEPPSKPQHVYVPNNYLVPLRWGVRCDLANGVMPKKLPFPLSPS
Tissue specificity：Expressed in hippocampus and dentate gyrus of 3-month adult brain. {ECO:0000269|PubMed:15843405}.
Induction：
Developmental stage：Detected at each embryonic stage, the highest expression level observed at 11 dpc. {ECO:0000269|PubMed:15843405}.
Protein families：HYLS1 family