HPBP1_RAT   Q6IMX7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6IMX7

Recommended name:Hsp70-binding protein 1

EC number:

Alternative names:Heat shock protein-binding protein 1 Hsp70-interacting protein 1

Cleaved into:

GeneID:246146

Gene names  (primary ):Hspbp1

Gene names  (synonym ):Hspbp

Gene names  (ORF ):

Length:357

Mass:39,191

Sequence:MADKGSGGSRLPLALPPASQGCSSGSSGSSAGGSGNPRLPRNLQGLLQMAITAGSEEPDPPPEPMSEERRQWLQEAMSAAFRGQREEVEQMKNCLRVLSQATPPTAGEAELATDQQEREGALELLADLCENMDNAADFCQLSGMHLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQEQVLGLGALRKLLRLLDRDSCDTVRVKALFAISCLVREQEAGLLQFLRLDGFSVLMRAMQQQVQKLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTEHSPFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQTCFSSPTDDSMDR

Tissue specificity:Ubiquitous. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp